Return to main results Retrieve Phyre Job Id

Job DescriptionP0AAZ0
Confidence3.15%DateThu Jan 5 11:14:11 GMT 2012
Rank40Aligned Residues35
% Identity37%Templatec2j6pF_
PDB info PDB header:oxidoreductaseChain: F: PDB Molecule:sb(v)-as(v) reductase; PDBTitle: structure of as-sb reductase from leishmania major
Resolution2.15 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   82.......90.........100.........110.........120......
Predicted Secondary structure 









Query SS confidence 












































Query Sequence  CAFSLVKGRRWARWLYLLTQITAASYLWAASLGYGYPELFSIPGE
Query Conservation 

 

  
 




 

  
 

  


 

 
   





 

Alig confidence 





















..........












Template Conservation 
  
  


  
  
       ..........    
 



 

Template Sequence  CAQSLVRAPKGANRFALAQKKL. . . . . . . . . . GYVLPAVYVLRGG
Template Known Secondary structure 
SSSSS..........T


STT
Template Predicted Secondary structure 





..........






Template SS confidence 












































   75....80.........90...... ...100.........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions