Return to main results Retrieve Phyre Job Id

Job DescriptionP0A9E9
Confidence84.19%DateThu Jan 5 11:10:01 GMT 2012
Rank254Aligned Residues38
% Identity24%Templatec2kpjA_
PDB info PDB header:transcription regulatorChain: A: PDB Molecule:sos-response transcriptional repressor, lexa; PDBTitle: solution structure of protein sos-response transcriptional2 repressor, lexa from eubacterium rectale. northeast3 structural genomics consortium target err9a
ResolutionUNK

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   156...160.........170.........180.........190.........200......
Predicted Secondary structure 












Query SS confidence 


















































Query Sequence  HEKHTQAAEYLGVSYRHLLYVLAQFIHDGLLIKSKKGYLIKNRKQLSGLAL
Query Conservation        

  

 

 

 
 
  
   


      
 
 
   
   
 
Alig confidence 





















.............















Template Conservation    

  

   


  


  
............. 
   
    
  

 
Template Sequence  EKTQLEIAKSIGVSPQTFNTWC. . . . . . . . . . . . . KGIAIPRMGKVQALAD
Template Known Secondary structure  SS
T

.............TTS



Template Predicted Secondary structure 


.............


Template SS confidence 


















































   22.......30.........40... ......50.........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions