Return to main results Retrieve Phyre Job Id

Job DescriptionP15069
Confidence9.98%DateThu Jan 5 11:34:32 GMT 2012
Rank41Aligned Residues33
% Identity27%Templatec3go6B_
PDB info PDB header:transferaseChain: B: PDB Molecule:ribokinase rbsk; PDBTitle: crystal structure of m. tuberculosis ribokinase (rv2436) in2 complex with ribose and amp-pnp
Resolution1.98 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   56...60.........70.........80.........90.......
Predicted Secondary structure 

















Query SS confidence 









































Query Sequence  YAYGGSLYARTQVKNVQLISMTLPDINAGCGGIDAYLGSFSF
Query Conservation 





   
 
     
 

  

  








 




Alig confidence 







.










......




..








Template Conservation          .   
    


......




..


 

 
 
Template Sequence  YVGADGVF. EVPAPTVTPVD. . . . . . TAGAG. . DVFAGVLAA
Template Known Secondary structure  TT.






S
......
TT..
Template Predicted Secondary structure 

.








......



..
Template SS confidence 









































   218.220..... ....230...... ...240. ........250
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions