Return to main results Retrieve Phyre Job Id

Job DescriptionP33607
Confidence1.74%DateThu Jan 5 11:52:25 GMT 2012
Rank76Aligned Residues31
% Identity32%Templatec1ql1A_
PDB info PDB header:virusChain: A: PDB Molecule:pf1 bacteriophage coat protein b; PDBTitle: inovirus (filamentous bacteriophage) strain pf1 major coat2 protein assembly
Resolution3.1 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   301........310.........320.........330.........
Predicted Secondary structure 
Query SS confidence 






































Query Sequence  QTDIKRVLAYSTMSQIGYMFLALGVQAWDAAIFHLMTHA
Query Conservation 
 
 










 
 
    
 
    
  


 

Alig confidence 






........























Template Conservation 






........























Template Sequence  QGDMKAI. . . . . . . . GGYIVGALVILAVAGLIYSMLRKA
Template Known Secondary structure  ........
Template Predicted Secondary structure 

........
Template SS confidence 






































   16...20.. .......30.........40......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions