Return to main results Retrieve Phyre Job Id

Job DescriptionP78271
Confidence5.04%DateThu Jan 5 12:33:11 GMT 2012
Rank50Aligned Residues23
% Identity22%Templatec3f55A_
PDB info PDB header:hydrolase, allergenChain: A: PDB Molecule:beta-1,3-glucanase; PDBTitle: crystal structure of the native endo beta-1,3-glucanase (hev b 2), a2 major allergen from hevea brasiliensis (space group p41)
Resolution2.80 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   27..30.........40.........50......
Predicted Secondary structure 










Query SS confidence 





























Query Sequence  VNYGKVGSIGKFQTKEFDNEEQCLKEASKL
Query Conservation 
  




 

   
 
 
   
 
   

Alig confidence 








.......













Template Conservation 
 

    
.......



  

 



 
Template Sequence  VCYGMQGNN. . . . . . . LPPVSEVIALYKKS
Template Known Secondary structure 




SS.......


Template Predicted Secondary structure 





.......



Template SS confidence 





























   4.....10.. .......20......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions