Return to main results Retrieve Phyre Job Id

Job DescriptionP78271
Confidence6.47%DateThu Jan 5 12:33:11 GMT 2012
Rank40Aligned Residues50
% Identity18%Templatec2bnlE_
PDB info PDB header:stress-responseChain: E: PDB Molecule:modulator protein rsbr; PDBTitle: the structure of the n-terminal domain of rsbr
Resolution2.0 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   138.140.........150.........160.........170.........180.........190.. .......200.........210.....
Predicted Secondary structure 




















..





Query SS confidence 






















































. .






















Query Sequence  CADFPQMLIETMWGMKYIAMDSILEEDVRAQLLVDEMSTIQSNMITYATAFGQIK. . VMGKISHKLKKMGLNALARHQLT
Query Conservation 
 

    

    
       
           
       
   

  




..
 
 

 
 
   
 

   
 
Alig confidence 















.............................









..


















..

Template Conservation 
 









 

 .............................
 



 

   
    
  
       

 ..
 
Template Sequence  ISELALRAVQIGLSXK. . . . . . . . . . . . . . . . . . . . . . . . . . . . . FLATALAEFWKRLYTKXNDKESTELIWQIDR. . FF
Template Known Secondary structure  TT

.............................T

..
Template Predicted Secondary structure 


.............................




..
Template SS confidence 















































































   67..70.........80.. .......90.........100.........110... ..
 
   216..
Predicted Secondary structure 
Query SS confidence 


Query Sequence  AKI
Query Conservation    
Alig confidence 


Template Conservation     
Template Sequence  SPI
Template Known Secondary structure 
Template Predicted Secondary structure 
Template SS confidence 


   121..
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions