Return to main results Retrieve Phyre Job Id

Job DescriptionP02359
Confidence6.15%DateThu Jan 5 10:57:31 GMT 2012
Rank25Aligned Residues25
% Identity40%Templatec3csxA_
PDB info PDB header:metal binding protein,unknown functionChain: A: PDB Molecule:putative uncharacterized protein; PDBTitle: structural characterization of a protein in the duf6832 family- crystal structure of cce_0567 from the3 cyanobacterium cyanothece 51142.
Resolution1.84 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   131........140...... ...150.....
Predicted Secondary structure 

............
Query SS confidence 















. . . . . . . . . . . .








Query Sequence  KGTAVKKREDVHRMAE. . . . . . . . . . . . ANKAFAHYR
Query Conservation   
 









 

............








Alig confidence 















............








Template Conservation   


 
 








 

  
  
  

  

  
 
Template Sequence  NSKAGQMKMDLHDLAEGLPTDYENLVETAEKTYEIFR
Template Known Secondary structure  TTTTGGG
Template Predicted Secondary structure 





Template SS confidence 




































   25....30.........40.........50.........60.
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions