Return to main results Retrieve Phyre Job Id

Job DescriptionP02359
Confidence5.93%DateThu Jan 5 10:57:31 GMT 2012
Rank29Aligned Residues35
% Identity37%Templatec2js5B_
PDB info PDB header:structural genomics, unknown functionChain: B: PDB Molecule:uncharacterized protein; PDBTitle: nmr structure of protein q60c73_metca. northeast structural2 genomics consortium target mcr1
ResolutionUNK

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   121........130 .........140...... ...150.....
Predicted Secondary structure 

.

............
Query SS confidence 









.















. . . . . . . . . . . .








Query Sequence  ANELSDAAEN. KGTAVKKREDVHRMAE. . . . . . . . . . . . ANKAFAHYR
Query Conservation 
 


 
   . 
 









 

............








Alig confidence 









.















............








Template Conservation 

 

  



 


 
 








 

  
  
 


 


  
 
Template Sequence  AEELKAKLKKLNAQATALKMDLHDLAEDLPTGWNRIMEVAEKTYEAYR
Template Known Secondary structure  TTTSSGGG
Template Predicted Secondary structure 





Template SS confidence 















































   5....10.........20.........30.........40.........50..
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions