Return to main results Retrieve Phyre Job Id

Job DescriptionP77608
Confidence6.62%DateThu Jan 5 12:30:59 GMT 2012
Rank53Aligned Residues44
% Identity9%Templatec1gr3A_
PDB info PDB header:collagenChain: A: PDB Molecule:collagen x; PDBTitle: structure of the human collagen x nc1 trimer
Resolution2.0 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   181........190.........200.........210.........220.........230.........240........
Predicted Secondary structure 






























Query SS confidence 



































































Query Sequence  CAMKMTRNNEEVSSGRGSECLGHPLNAAVWLARKMASLGEPLRTGDIILTGALGPMVAVNAGDRFEAH
Query Conservation      
  

  
  
      
 
   
  
   
   
  
 




 


  
      

 
   
Alig confidence 






















........................




















Template Conservation    
 
 

               ........................   

 
 

 
  

 
 
 
Template Sequence  VWVGLYKNGTPVMYTYDEYTKGY. . . . . . . . . . . . . . . . . . . . . . . . LDQASGSAIIDLTENDQVWLQ
Template Known Secondary structure  TT

BTTB........................

TT
Template Predicted Secondary structure 








........................





Template SS confidence 



































































   610.........620.........630.. .......640.........650...
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions