Return to main results Retrieve Phyre Job Id

Job DescriptionP0AF70
Confidence2.48%DateThu Jan 5 11:25:25 GMT 2012
Rank89Aligned Residues22
% Identity5%Templatec3kzfC_
PDB info PDB header:transferaseChain: C: PDB Molecule:carbamate kinase; PDBTitle: structure of giardia carbamate kinase
Resolution3.00 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   7980.........90.........100.........110......
Predicted Secondary structure 



















Query SS confidence 





































Query Sequence  AAAMGGNVIYGISSPSQGMLSSFVPTDSQIIGQVYKCP
Query Conservation 

 







 
            
 

  
 

 

Alig confidence 
















................




Template Conservation 
  
 

 

 



 
................
    
Template Sequence  AKTLNSDYLMILTDVLN. . . . . . . . . . . . . . . . ACINY
Template Known Secondary structure  TT
SSSSS................SS
Template Predicted Secondary structure 







................


Template SS confidence 





































   224.....230.........240 .....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions