Return to main results Retrieve Phyre Job Id

Job DescriptionP0AF70
Confidence4.23%DateThu Jan 5 11:25:25 GMT 2012
Rank44Aligned Residues22
% Identity23%Templatec2w21A_
PDB info PDB header:transferaseChain: A: PDB Molecule:glutamate 5-kinase; PDBTitle: crystal structure of the aminoacid kinase domain of the2 glutamate 5 kinase of escherichia coli.
Resolution2.95 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   7980.........90.........100.........110......
Predicted Secondary structure 



















Query SS confidence 





































Query Sequence  AAAMGGNVIYGISSPSQGMLSSFVPTDSQIIGQVYKCP
Query Conservation 

 







 
            
 

  
 

 

Alig confidence 
















................




Template Conservation 
  
 
  

  


 
................

  
Template Sequence  AILAGADKLLLLTDQKG. . . . . . . . . . . . . . . . LYTAD
Template Known Secondary structure  TT
SSSSS................
BSS
Template Predicted Secondary structure 








................




Template SS confidence 





































   157..160.........170... .....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions