Return to main results Retrieve Phyre Job Id

Job DescriptionP39336
Confidence11.51%DateThu Jan 5 11:59:27 GMT 2012
Rank20Aligned Residues25
% Identity56%Templated2pgca1
SCOP infoFerredoxin-like Dimeric alpha+beta barrel Marine metagenome family DABB3
Resolution2.53

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   62.......70.........80.........90...
Predicted Secondary structure 













Query SS confidence 































Query Sequence  IFTLGYVDFSKRSNEAGRNMMAHIKSSSYSKD
Query Conservation 























  


 

Alig confidence 


















.......





Template Conservation 













 


 .......





Template Sequence  ILTVASVDFSYRETXARLX. . . . . . . SSYSKD
Template Known Secondary structure 
GGG.......
Template Predicted Secondary structure 

.......
Template SS confidence 































   8.10.........20...... ...30..
 
Download:Text version FASTA pairwise alignment 3D Model in PDB format

View in Jmol

Send structure to FirstGlance for more viewing options


Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions