Phyre Home Retrieve Phyre Job Id
Emaill.a.kelley@imperial.ac.uk
DescriptionP0AFM4
DateThu Jan 5 11:26:45 GMT 2012
Unique Job IDf4842295faa1f66c

Summary 

Top model
Image coloured by rainbow N → C terminus
Model (left) based on template d1heka_
Top template information
Fold:Retroviral matrix proteins
Superfamily:Retroviral matrix proteins
Family:EIAV matrix antigen
Confidence and coverage
Confidence: 13.5% Coverage: 10%
11 residues ( 10% of your sequence) have been modelled with 13.5% confidence by the single highest scoring template.
You may wish to submit your sequence to Phyrealarm. This will automatically scan your sequence every week for new potential templates as they appear in the Phyre2 library.
Please note: You must be registered and logged in to use Phyrealarm.
3D viewing
Interactive 3D view in Jmol

Sequence analysis 

Secondary structure and disorder prediction 

   1........10.........20.........30.........40.........50.........60
Sequence  MKITLLVTLLFGLVFLTTVGAAERTLTPQQQRMTSCNQQATAQALKGDARKTYMSDCLKN
Secondary structure 









SS confidence 



























































Disorder  ???











????????????








?

????????










??
Disorder confidence 



























































 
   .........70.........80.........90.........100......
Sequence  SKSAPGEKSLTPQQQKMRECNNQATQQSLKGDDRNKFMSACLKKAA
Secondary structure 














SS confidence 













































Disorder  ????????????







???
??????











????
Disorder confidence 













































 

Confidence Key
High(9)                    Low (0)
?Disordered
Alpha helix
Beta strand

Domain analysis 

Hover over an aligned region to see model and summary info

Please note, only up to the top 20 hits are modelled to reduce computer load

RankAligned region

PDB 1hek chain A

3D model

Region: 43 - 53
Aligned: 11
Modelled: 11
Confidence: 13.5%
Identity: 36%
Fold: Retroviral matrix proteins
Superfamily: Retroviral matrix proteins
Family: EIAV matrix antigen

Phyre2

PDB 3dwl chain E

3D model

Region: 97 - 104
Aligned: 8
Modelled: 8
Confidence: 8.4%
Identity: 50%
PDB header:structural protein
Chain: E: PDB Molecule:actin-related protein 2/3 complex subunit 3;
PDBTitle: crystal structure of fission yeast arp2/3 complex lacking the arp22 subunit

Phyre2

PDB 2bmf chain A domain 1

3D model

Region: 45 - 53
Aligned: 9
Modelled: 9
Confidence: 8.3%
Identity: 67%
Fold: P-loop containing nucleoside triphosphate hydrolases
Superfamily: P-loop containing nucleoside triphosphate hydrolases
Family: RNA helicase

Phyre2
1

d1heka_
2

c3dwlE_
3

d2bmfa1



Detailed template information 

#
Template Alignment Coverage3D Model Confidence
% i.d. Template Information
1d1heka_



13.5 36 Fold:Retroviral matrix proteins
Superfamily:Retroviral matrix proteins
Family:EIAV matrix antigen
2c3dwlE_



8.4 50 PDB header:structural protein
Chain: E: PDB Molecule:actin-related protein 2/3 complex subunit 3;
PDBTitle: crystal structure of fission yeast arp2/3 complex lacking the arp22 subunit
3d2bmfa1



8.3 67 Fold:P-loop containing nucleoside triphosphate hydrolases
Superfamily:P-loop containing nucleoside triphosphate hydrolases
Family:RNA helicase

Binding site prediction 

Due to computational demand, binding site predictions are not run for batch jobs

If you want to predict binding sites, please manually submit your model of choice to 3DLigandSite



Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
If you use the binding site predictions from 3DLigandSite, please also cite:
3DLigandSite: predicting ligand-binding sites using similar structures.
Wass MN, Kelley LA and Sternberg MJ Nucleic Acids Research 38, W469-73 (2010) [PubMed]
 
© Structural Bioinformatics Group
Imperial College London
Lawrence Kelley, Benjamin Jefferys
Disclaimer
Terms and Conditions
Component software
Template detection: HHpred 1.51
Secondary structure prediction: Psi-pred 2.5
Disorder prediction: Disopred 2.4
Transmembrane prediction: Memsat_SVM
Multi-template modelling and ab initio: Poing 1.0