Return to main results Retrieve Phyre Job Id

Job DescriptionP31827
Confidence2.17%DateThu Jan 5 11:48:51 GMT 2012
Rank55Aligned Residues41
% Identity27%Templatec3ml6D_
PDB info PDB header:protein transportChain: D: PDB Molecule:chimeric complex between protein dishevlled2 homolog dvl-2 PDBTitle: a complex between dishevlled2 and clathrin adaptor ap-2
Resolution3.50 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   98.100.........110.........120.........130.........140.........150.........160.........170..
Predicted Secondary structure 

















































Query SS confidence 










































































Query Sequence  GASPYQNAYLIDGISATNNLNPANESDASSATNISGMSQGYYLDVSLLDNVTLYDSFVPVEFGRFNGGVIDAKIK
Query Conservation 
         


                             
    

 





  
  

 
 





 

Alig confidence 











..................................




























Template Conservation      







..................................


 
  
    
 

 
 
 
 
  

 
Template Sequence  GSGGSRNELFLD. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . VLESVNLLMSPQGQVLSAHVSGRVVMKSY
Template Known Secondary structure 



..................................
TTS
Template Predicted Secondary structure 






..................................




Template SS confidence 










































































   1165....1170...... ...1180.........1190.........1200.....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions