Return to main results Retrieve Phyre Job Id

Job DescriptionP0A6L9
Confidence8.76%DateThu Jan 5 11:03:30 GMT 2012
Rank52Aligned Residues22
% Identity36%Templatec3h1yA_
PDB info PDB header:isomeraseChain: A: PDB Molecule:mannose-6-phosphate isomerase; PDBTitle: crystal structure of mannose 6-phosphate isomerase from2 salmonella typhimurium bound to substrate (f6p)and metal3 atom (zn)
Resolution2.04 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   27..30.........40.........50.......
Predicted Secondary structure 










Query SS confidence 






























Query Sequence  LQRQYHPDKFASGSQAEQLAAVQQSATINQA
Query Conservation 

   



           
   
  
  
Alig confidence 








.........












Template Conservation 







 .........  
      
   
Template Sequence  LSIQVHPNK. . . . . . . . . RNSEIGFAKENAA
Template Known Secondary structure 





.........T
Template Predicted Secondary structure 




.........



Template SS confidence 






























   94.....100.. .......110.....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions