Return to main results Retrieve Phyre Job Id

Job DescriptionP0A6L9
Confidence8.20%DateThu Jan 5 11:03:30 GMT 2012
Rank58Aligned Residues42
% Identity33%Templatec1uf2A_
PDB info PDB header:virusChain: A: PDB Molecule:core protein p3; PDBTitle: the atomic structure of rice dwarf virus (rdv)
Resolution3.50 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   4.....10.........20.........30.........40.........50.........60...
Predicted Secondary structure 





















Query SS confidence 



























































Query Sequence  FTLFGLPARYQLDTQALSLRFQDLQRQYHPDKFASGSQAEQLAAVQQSATINQAWQTLRH
Query Conservation 
 



      
  






 

   



           
   
  
  

 

 
Alig confidence 
















............








......















Template Conservation 
 



 
 


  


............








......










  


Template Sequence  FGVFGIVPQYQILNEAV. . . . . . . . . . . . PDFFAGGED. . . . . . ILILQLIRAVYDTLSN
Template Known Secondary structure  B


SS





............

BTTTT......
Template Predicted Secondary structure 






............





......
Template SS confidence 



























































   643......650......... 660........ .670.........680....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions