Return to main results Retrieve Phyre Job Id

Job DescriptionP08370
Confidence3.51%DateThu Jan 5 11:01:18 GMT 2012
Rank57Aligned Residues20
% Identity10%Templatec1sg7A_
PDB info PDB header:structural genomics, unknown functionChain: A: PDB Molecule:putative cation transport regulator chab; PDBTitle: nmr solution structure of the putative cation transport2 regulator chab
ResolutionUNK

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   3940.........50. .......
Predicted Secondary structure  ...................
Query SS confidence 












. . . . . . . . . . . . . . . . . . .






Query Sequence  SMESQSLRRQAIV. . . . . . . . . . . . . . . . . . . QSALAWG
Query Conservation    
  

 




................... 





Alig confidence 












...................






Template Conservation 


 

  


 
   
      
 
   
  
  


 
Template Sequence  HAQDIYKEAFNSAWDQYKDKEDRRDDASREETAHKVAWA
Template Known Secondary structure 

SSSSSS
Template Predicted Secondary structure 











Template SS confidence 






































   40.........50.........60.........70........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions