Return to main results Retrieve Phyre Job Id

Job DescriptionP08555
Confidence2.52%DateThu Jan 5 11:01:32 GMT 2012
Rank15Aligned Residues28
% Identity32%Templatec2jwaA_
PDB info PDB header:transferaseChain: A: PDB Molecule:receptor tyrosine-protein kinase erbb-2; PDBTitle: erbb2 transmembrane segment dimer spatial structure
ResolutionUNK

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   47..50.........60.........70.........80..
Predicted Secondary structure 
Query SS confidence 



































Query Sequence  GPLDMVNAIESGIGGTLGFLAAVIGLGTILGKMMEV
Query Conservation             
          

  
   
 

  
Alig confidence 










........
















Template Conservation 










........
















Template Sequence  PLTSIISAVVG. . . . . . . . ILLVVVLGVVFGILIKR
Template Known Secondary structure  S........
Template Predicted Secondary structure  ........
Template SS confidence 



































   50.........60 .........70.......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions