Return to main results Retrieve Phyre Job Id

Job DescriptionP13959
Confidence65.05%DateThu Jan 5 11:33:47 GMT 2012
Rank3Aligned Residues38
% Identity34%Templated1rioa_
SCOP infolambda repressor-like DNA-binding domains lambda repressor-like DNA-binding domains Phage repressors
Resolution2.30

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   20.........30.........40.........50.........60.........70....
Predicted Secondary structure 












Query SS confidence 






















































Query Sequence  KGNPVPARERQRASLARRSNTHKAFHAVIQARLKDRLSELADEEGITQAQMLEKL
Query Conservation 





  


  





 




 


 
 

  
 


   





 

 
Alig confidence 












.................
























Template Conservation               .................  
   

  
   



 


   
Template Sequence  KKKPLTQEQLEDA. . . . . . . . . . . . . . . . . RRLKAIYEKKKNELGLSQESVADKX
Template Known Secondary structure  SS



.................T

Template Predicted Secondary structure 





.................



Template SS confidence 






















































   4.....10...... ...20.........30.........40.
 
Download:Text version FASTA pairwise alignment 3D Model in PDB format

View in Jmol

Send structure to FirstGlance for more viewing options


Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions