Return to main results Retrieve Phyre Job Id

Job DescriptionP0ADM6
Confidence25.94%DateThu Jan 5 11:21:22 GMT 2012
Rank4Aligned Residues25
% Identity32%Templated3c0na1
SCOP infoC-type lectin-like C-type lectin-like Aerolysin/Pertussis toxin (APT) domain
Resolution2.20

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   47..50.........60.........70.........
Predicted Secondary structure 











Query SS confidence 
































Query Sequence  TITGLSQAKDSNGTKGYVFVGESLDYLITDGAD
Query Conservation   
 
 
      
 
 







 



 
  
Alig confidence 




........



















Template Conservation 




........  





 

 



    
Template Sequence  QISGL. . . . . . . . ANGWVIMGPGYNGEIKPGTA
Template Known Secondary structure 
........TTT
GGGTT



Template Predicted Secondary structure  ........













Template SS confidence 
































   46...50 .........60.........70
 
Download:Text version FASTA pairwise alignment 3D Model in PDB format

View in Jmol

Send structure to FirstGlance for more viewing options


Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions