Return to main results Retrieve Phyre Job Id

Job DescriptionP0ADM6
Confidence5.25%DateThu Jan 5 11:21:22 GMT 2012
Rank11Aligned Residues23
% Identity35%Templatec3c0mB_
PDB info PDB header:toxinChain: B: PDB Molecule:aerolysin; PDBTitle: crystal structure of the proaerolysin mutant y221g
Resolution2.88 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   47..50.........60.........70.......
Predicted Secondary structure 











Query SS confidence 






























Query Sequence  TITGLSQAKDSNGTKGYVFVGESLDYLITDG
Query Conservation   
 
 
      
 
 







 



 
Alig confidence 




........

















Template Conservation 

 

........    



 

   

  
Template Sequence  QISGL. . . . . . . . ANGWVIMGPGYNGEIKPG
Template Known Secondary structure 

........STT
GGGTS

Template Predicted Secondary structure 
........












Template SS confidence 






























   46...50 .........60........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions