Return to main results Retrieve Phyre Job Id

Job DescriptionP62399
Confidence38.77%DateThu Jan 5 12:07:30 GMT 2012
Rank9Aligned Residues29
% Identity38%Templatec2rf4B_
PDB info PDB header:transferaseChain: B: PDB Molecule:dna-directed rna polymerase i subunit rpa4; PDBTitle: crystal structure of the rna polymerase i subcomplex a14/43
Resolution3.10 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   91........100..... ....110. ........
Predicted Secondary structure 
................
.







Query SS confidence 














. . . . . . . . . . . . . . . .





.







Query Sequence  LRGERMWEFFERLIT. . . . . . . . . . . . . . . . IAVPRI. RDFRGLSA
Query Conservation 


  

 

 


 ................ 




.


 
   
Alig confidence 














................





.







Template Conservation 



  
 

  

 


     

 



















Template Sequence  VSTDEVLQFLESFIDEKENIIDIDTNLSSSISQLKRIQRDFKGLPP
Template Known Secondary structure 

SSS


TTS

Template Predicted Secondary structure 






Template SS confidence 













































   31........40.........50.........60.........70......
 
Download:Text version FASTA pairwise alignment 3D Model in PDB format

View in Jmol

Send structure to FirstGlance for more viewing options


Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions