Return to main results Retrieve Phyre Job Id

Job DescriptionP37650
Confidence21.37%DateWed Jan 25 15:20:52 GMT 2012
Rank183Aligned Residues46
% Identity22%Templatec2gr7C_
PDB info PDB header:membrane proteinChain: C: PDB Molecule:adhesin; PDBTitle: hia 992-1098
Resolution2.30 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   1023......1030.........1040.........1050.........1060.........1070.........1080.........1090.........1100..
Predicted Secondary structure 
































Query SS confidence 















































































Query Sequence  GYYSPQEYLSFAIPVMWRERTENWSWELGASGSWSHSRTKTMPRYPLMNLIPTDWQEEAARQSNDGGSSQGFGYTARALL
Query Conservation 





 
     
                               
                        
         
Alig confidence 











..


















..................................












Template Conservation 
 
 
  




.. 
    
     
   
  ..................................
      





Template Sequence  SSYQGQNGLAIG. . VSRISDNGKVIIRLSGTTN. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . SQGKTGVAAGVGY
Template Known Secondary structure  TT..
TTS
..................................TT


Template Predicted Secondary structure 




..



..................................



Template SS confidence 















































































   1053......1060.... .....1070.........1080... ......1090......
 
   1103.
Predicted Secondary structure 
Query SS confidence 

Query Sequence  ER
Query Conservation    
Alig confidence 

Template Conservation   
Template Sequence  QW
Template Known Secondary structure 

Template Predicted Secondary structure 
Template SS confidence 

   1097.
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions