Return to main results Retrieve Phyre Job Id

Job DescriptionP0A6G7
Confidence20.73%DateThu Jan 5 11:03:07 GMT 2012
Rank148Aligned Residues29
% Identity24%Templatec3qodB_
PDB info PDB header:dna binding proteinChain: B: PDB Molecule:heterocyst differentiation protein; PDBTitle: crystal structure of heterocyst differentiation protein, hetr from2 fischerella mv11
Resolution3.38 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   47..50.........60.........70.........80..
Predicted Secondary structure 














Query SS confidence 



































Query Sequence  GQVEDHMANLIVAQMLFLEAENPEKDIYLYINSPGG
Query Conservation 
 
    
  

  
  
   
  
 
 
 





Alig confidence 

















.......










Template Conservation 

















.......



 





Template Sequence  XPLSEALAEHIKRRLLYS. . . . . . . GTVTRIDSPWG
Template Known Secondary structure 



.......TS

SSS
Template Predicted Secondary structure 
.......





Template SS confidence 



































   179180.........190...... ...200.......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions