Return to main results Retrieve Phyre Job Id

Job DescriptionP56258
Confidence7.27%DateThu Jan 5 12:06:20 GMT 2012
Rank97Aligned Residues26
% Identity19%Templatec2z5cA_
PDB info PDB header:chaperone/hydrolaseChain: A: PDB Molecule:protein ypl144w; PDBTitle: crystal structure of a novel chaperone complex for yeast2 20s proteasome assembly
Resolution2.90 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   188.190....... ..200.........210...
Predicted Secondary structure 








.......



Query SS confidence 









. . . . . . .















Query Sequence  VGNSGDRSNE. . . . . . . HIAALRAVHQQFGDTV
Query Conservation 









.......




  
       
Alig confidence 









.......















Template Conservation 
  

  
        


 


 

  
   
Template Sequence  VTWSSLPSEDPSMLVANHLYILKKCLDLLKTEL
Template Known Secondary structure 
TT

TTT
Template Predicted Secondary structure 









Template SS confidence 
































   114.....120.........130.........140......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions