Return to main results Retrieve Phyre Job Id

Job DescriptionP23173
Confidence5.13%DateThu Jan 5 11:39:16 GMT 2012
Rank14Aligned Residues24
% Identity25%Templatec1llcA_
PDB info PDB header:oxidoreductase(choh(d)-nad(a))Chain: A: PDB Molecule:l-lactate dehydrogenase; PDBTitle: structure determination of the allosteric l-lactate dehydrogenase from2 lactobacillus casei at 3.0 angstroms resolution
Resolution3.00 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   1........10.........20.........30.....
Predicted Secondary structure 

Query SS confidence 


































Query Sequence  MTDQAEKKHSAFWGVMVIAGTVIGGGMFALPVDLA
Query Conservation         
 
       
    

 


 

    
Alig confidence 










...........












Template Conservation         

 
...........



 

   
  
Template Sequence  ITDKDHQKVIL. . . . . . . . . . . VGDGAVGSSYAFA
Template Known Secondary structure  S



S

...........S
TT
Template Predicted Secondary structure 






...........


Template SS confidence 


































   15....20..... ....30........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions