Return to main results Retrieve Phyre Job Id

Job DescriptionP45549
Confidence11.24%DateThu Jan 5 12:03:06 GMT 2012
Rank57Aligned Residues24
% Identity13%Templated1dt9a3
SCOP infoN-terminal domain of eukaryotic peptide chain release factor subunit 1, ERF1 N-terminal domain of eukaryotic peptide chain release factor subunit 1, ERF1 N-terminal domain of eukaryotic peptide chain release factor subunit 1, ERF1
Resolution2.70

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   314.....320........ .330.......
Predicted Secondary structure 

......



Query SS confidence 














. . . . . .








Query Sequence  QVVDRNLARLVEAMQ. . . . . . PDDCLVVMA
Query Conservation     
  

 

  
 ......








Alig confidence 














......








Template Conservation    
  

 

  


 
   





 
 
Template Sequence  LSVLGAITSVQQRLKLYNKVPPNGLVVYCG
Template Known Secondary structure  TT
SS

TT
Template Predicted Secondary structure 






Template SS confidence 





























   6970.........80.........90........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions