Return to main results Retrieve Phyre Job Id

Job DescriptionP31666
Confidence30.13%DateThu Jan 5 11:48:29 GMT 2012
Rank319Aligned Residues33
% Identity15%Templatec3dqzB_
PDB info PDB header:lyaseChain: B: PDB Molecule:alpha-hydroxynitrile lyase-like protein; PDBTitle: structure of the hydroxynitrile lyase from arabidopsis2 thaliana
Resolution2.50 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   171........180.........190.........200.........210.......
Predicted Secondary structure 

















Query SS confidence 














































Query Sequence  SVLTYHHILRDEENTRFRHTSTTTSVRAFNNQMAWLRDRGYATLSMV
Query Conservation 





 
               

   
  

  
   

  


 
Alig confidence 





..............


























Template Conservation 





..............
       
      
   
  


 
Template Sequence  HFVLVH. . . . . . . . . . . . . . NAYHGAWIWYKLKPLLESAGHRVTAVE
Template Known Secondary structure 
..............
TT

GGGGTTTT

Template Predicted Secondary structure 

..............








Template SS confidence 














































   6...10. ........20.........30........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions