Return to main results Retrieve Phyre Job Id

Job DescriptionP31666
Confidence37.65%DateThu Jan 5 11:48:29 GMT 2012
Rank299Aligned Residues45
% Identity16%Templatec3bjrA_
PDB info PDB header:hydrolaseChain: A: PDB Molecule:putative carboxylesterase; PDBTitle: crystal structure of a putative carboxylesterase (lp_1002) from2 lactobacillus plantarum wcfs1 at 2.09 a resolution
Resolution2.09 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   156...160.........170.........180.........190.........200.........210.......
Predicted Secondary structure 


























Query SS confidence 





























































Query Sequence  LAYISALDAQPDNGLSVLTYHHILRDEENTRFRHTSTTTSVRAFNNQMAWLRDRGYATLSMV
Query Conservation   

        
 







 
               

   
  

  
   

  


 
Alig confidence 






.......







..........





























Template Conservation   
     ....... 
 

  
..........


            
  

  
  
   
Template Sequence  TGYLHTN. . . . . . . LPAIIIVP. . . . . . . . . . GGSYTHIPVAQAESLAXAFAGHGYQAFYLE
Template Known Secondary structure 


.......
..........
STTT


TTT
Template Predicted Secondary structure 


.......


..........










Template SS confidence 





























































   16...20.. .......30 .........40.........50.........60
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions