Return to main results Retrieve Phyre Job Id

Job DescriptionP31666
Confidence24.24%DateThu Jan 5 11:48:29 GMT 2012
Rank346Aligned Residues38
% Identity16%Templatec3bf7B_
PDB info PDB header:hydrolaseChain: B: PDB Molecule:esterase ybff; PDBTitle: 1.1 resolution structure of ybff, a new esterase from2 escherichia coli: a unique substrate-binding crevice3 generated by domain arrangement
Resolution1.10 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   165....170.........180.........190.........200.........210.......
Predicted Secondary structure 






















Query SS confidence 




















































Query Sequence  QPDNGLSVLTYHHILRDEENTRFRHTSTTTSVRAFNNQMAWLRDRGYATLSMV
Query Conservation    
 







 
               

   
  

  
   

  


 
Alig confidence 











..............

















.







Template Conservation         




..............
              
  .   

  
Template Sequence  NQHNNSPIVLVH. . . . . . . . . . . . . . GLFGSLDNLGVLARDLVN. DHNIIQVD
Template Known Secondary structure  S






..............
TT

TTTTTT.TS

Template Predicted Secondary structure 






..............





.


Template SS confidence 




















































   12.......20... ......30.........40. ........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions