Return to main results Retrieve Phyre Job Id

Job DescriptionP31666
Confidence23.29%DateThu Jan 5 11:48:29 GMT 2012
Rank349Aligned Residues48
% Identity19%Templatec1y37A_
PDB info PDB header:hydrolaseChain: A: PDB Molecule:fluoroacetate dehalogenase; PDBTitle: structure of fluoroacetate dehalogenase from burkholderia sp. fa1
Resolution1.50 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   150.... .....160.........170.........180.........190.........200.........210.......
Predicted Secondary structure 

.


























Query SS confidence 




.






























































Query Sequence  IRIGD. RLAYISALDAQPDNGLSVLTYHHILRDEENTRFRHTSTTTSVRAFNNQMAWLRDRGYATLSMV
Query Conservation 
   
.  

        
 







 
               

   
  

  
   

  


 
Alig confidence 




.







.....








..............

















.







Template Conservation 
   
  
 
   
..... 

 

 

..............
              
  .   

  
Template Sequence  VDVGDVTINCVVGG. . . . . SGPALLLLH. . . . . . . . . . . . . . GFPQNLHMWARVAPLLAN. EYTVVCAD
Template Known Secondary structure  TT.....SSS
..............
TT

GGGGTTTT.TS
Template Predicted Secondary structure 


.....



..............





.


Template SS confidence 




































































   10.........20... ......30.. .......40.........50 ........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions