Return to main results Retrieve Phyre Job Id

Job DescriptionP37794
Confidence8.88%DateThu Jan 5 11:57:42 GMT 2012
Rank80Aligned Residues37
% Identity19%Templatec2k29A_
PDB info PDB header:transcriptionChain: A: PDB Molecule:antitoxin relb; PDBTitle: structure of the dbd domain of e. coli antitoxin relb
ResolutionUNK

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   102.......110.........120.........130.........140.........
Predicted Secondary structure 

















Query SS confidence 















































Query Sequence  QELVSQYLRFIELFGRKPTHLDSHHHVHMFPQIFPIVARFAAEQGIAL
Query Conservation   

 


  
    
  




 
 


  
 
           

  
Alig confidence 


















...........

















Template Conservation    

  
  

  


  
........... 

  
   

    


Template Sequence  DELKARSYAALEKMGVTPS. . . . . . . . . . . EALRLMLEYIADNERLPF
Template Known Secondary structure  TT

...........SS
S
Template Predicted Secondary structure 


...........




Template SS confidence 















































   10.........20........ .30.........40......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions