Return to main results Retrieve Phyre Job Id

Job DescriptionP33224
Confidence10.13%DateThu Jan 5 11:51:23 GMT 2012
Rank81Aligned Residues26
% Identity31%Templatec2qsdB_
PDB info PDB header:structural genomics, unknown functionChain: B: PDB Molecule:uncharacterized conserved protein; PDBTitle: crystal structure of a protein il1583 from idiomarina loihiensis
Resolution2.50 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   205....210. ... .....220.........230.
Predicted Secondary structure 


........





Query SS confidence 






. . . . . . .


.
















Query Sequence  DGSYRLV. . . . . . . GHK. WFFSVPQSDAHLVLAQT
Query Conservation 

 
 

.......
 
. 
 
   

  

 

 
Alig confidence 

.



.......


.
















Template Conservation 

.
 
 
         
 




 
   



  
Template Sequence  DG. YRIHLTSEAPEEKRLYFVNFGYHDFTVVVADS
Template Known Secondary structure  TT.S



SS



SSS
Template Predicted Secondary structure 

.











Template SS confidence 


































   65. ...70.........80.........90........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions