Return to main results Retrieve Phyre Job Id

Job DescriptionP09184
Confidence14.58%DateThu Jan 5 11:02:09 GMT 2012
Rank44Aligned Residues38
% Identity18%Templatec3llcA_
PDB info PDB header:hydrolaseChain: A: PDB Molecule:putative hydrolase; PDBTitle: crystal structure of putative hydrolase (yp_002548124.1) from2 agrobacterium vitis s4 at 1.80 a resolution
Resolution1.80 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   55....60.........70.........80.........90.........100.........110....
Predicted Secondary structure 





















Query SS confidence 



























































Query Sequence  DEYRCVIFTHGCFWHHHHCYLFKVPATRTEFWLEKIGKNVERDRRDISRLQELGWRVLIV
Query Conservation     
 





 



  
     
      
  
   
  

      
   

 



Alig confidence 

















......................



















Template Conservation     
 

  

       ......................         
   
  
   
Template Sequence  DERPTCIWLGGYRSDXTG. . . . . . . . . . . . . . . . . . . . . . TKALEXDDLAASLGVGAIRF
Template Known Secondary structure  TTS


TT

TTS......................T
Template Predicted Secondary structure 












......................



Template SS confidence 



























































   34.....40.........50. ........60.........70.
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions