Return to main results Retrieve Phyre Job Id

Job DescriptionP09184
Confidence12.42%DateThu Jan 5 11:02:09 GMT 2012
Rank53Aligned Residues39
% Identity23%Templatec3ksrA_
PDB info PDB header:hydrolaseChain: A: PDB Molecule:putative serine hydrolase; PDBTitle: crystal structure of a putative serine hydrolase (xcc3885) from2 xanthomonas campestris pv. campestris at 2.69 a resolution
Resolution2.69 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   48.50.........60.........70.........80.........90.........100.........110....
Predicted Secondary structure 






















Query SS confidence 


































































Query Sequence  GRPDFVVDEYRCVIFTHGCFWHHHHCYLFKVPATRTEFWLEKIGKNVERDRRDISRLQELGWRVLIV
Query Conservation 
 



    
 





 



  
     
      
  
   
  

      
   

 



Alig confidence 



....
















........................

















Template Conservation    
 ....  
 

  

  
    ........................       

  
  
   
Template Sequence  LTPT. . . . GXPGVLFVHGWGGSQHH. . . . . . . . . . . . . . . . . . . . . . . . SLVRAREAVGLGCICXTF
Template Known Secondary structure  ....S

TT

TTT........................TTTT


Template Predicted Secondary structure 

....








........................







Template SS confidence 


































































   22... ....30.........40.. .......50.........60
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions