Return to main results Retrieve Phyre Job Id

Job DescriptionP09184
Confidence54.07%DateThu Jan 5 11:02:09 GMT 2012
Rank9Aligned Residues45
% Identity24%Templatec3hxkB_
PDB info PDB header:hydrolaseChain: B: PDB Molecule:sugar hydrolase; PDBTitle: crystal structure of a sugar hydrolase (yeeb) from2 lactococcus lactis, northeast structural genomics3 consortium target kr108
Resolution3.20 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   4950........ .60.........70.........80.........90.........100.........110....
Predicted Secondary structure 


...


















Query SS confidence 









. . .























































Query Sequence  RPDFVVDEYR. . . CVIFTHGCFWHHHHCYLFKVPATRTEFWLEKIGKNVERDRRDISRLQELGWRVLIV
Query Conservation   



    
... 





 



  
     
      
  
   
  

      
   

 



Alig confidence 









...
















.....................

















Template Conservation      
       
 

  



   
    .....................    
  

  
  
   
Template Sequence  WVDFYQLQNYTFPAIIICPGGGYQHISQRE. . . . . . . . . . . . . . . . . . . . . SDPLALAFLAQGYQVLLL
Template Known Secondary structure 





B


STTTS

GGG.....................STT
Template Predicted Secondary structure 















.....................


Template SS confidence 




































































   26...30.........40.........50..... ....60.........70...
 
Download:Text version FASTA pairwise alignment 3D Model in PDB format

View in Jmol

Send structure to FirstGlance for more viewing options


Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions