Return to main results Retrieve Phyre Job Id

Job DescriptionP09184
Confidence15.03%DateThu Jan 5 11:02:09 GMT 2012
Rank42Aligned Residues34
% Identity24%Templatec3gzjB_
PDB info PDB header:hydrolaseChain: B: PDB Molecule:polyneuridine-aldehyde esterase; PDBTitle: crystal structure of polyneuridine aldehyde esterase2 complexed with 16-epi-vellosimine
Resolution2.19 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   57..60.........70.........80.........90.........100.........110....
Predicted Secondary structure 




















Query SS confidence 

























































Query Sequence  YRCVIFTHGCFWHHHHCYLFKVPATRTEFWLEKIGKNVERDRRDISRLQELGWRVLIV
Query Conservation   
 





 



  
     
      
  
   
  

      
   

 



Alig confidence 



















........................













Template Conservation   
 





       
   ........................   
   
  


 
Template Sequence  QKHFVLVHGGCLGAWIWYKL. . . . . . . . . . . . . . . . . . . . . . . . KPLLESAGHKVTAV
Template Known Secondary structure 



TT

GGGGTTT........................TT

Template Predicted Secondary structure 








........................


Template SS confidence 

























































   10.........20......... 30.........40...
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions