Return to main results Retrieve Phyre Job Id

Job DescriptionP09184
Confidence14.43%DateThu Jan 5 11:02:09 GMT 2012
Rank45Aligned Residues35
% Identity23%Templatec3dqzB_
PDB info PDB header:lyaseChain: B: PDB Molecule:alpha-hydroxynitrile lyase-like protein; PDBTitle: structure of the hydroxynitrile lyase from arabidopsis2 thaliana
Resolution2.50 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   56...60.........70.........80.........90.........100.........110....
Predicted Secondary structure 





















Query SS confidence 


























































Query Sequence  EYRCVIFTHGCFWHHHHCYLFKVPATRTEFWLEKIGKNVERDRRDISRLQELGWRVLIV
Query Conservation    
 





 



  
     
      
  
   
  

      
   

 



Alig confidence 




















........................













Template Conservation 

 






       
   ........................   
   
  


 
Template Sequence  RKHHFVLVHNAYHGAWIWYKL. . . . . . . . . . . . . . . . . . . . . . . . KPLLESAGHRVTAV
Template Known Secondary structure 




TT

GGGGTT........................TT
Template Predicted Secondary structure 









........................


Template SS confidence 


























































   3......10.........20... ......30.......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions