Return to main results Retrieve Phyre Job Id

Job DescriptionP09184
Confidence12.86%DateThu Jan 5 11:02:09 GMT 2012
Rank50Aligned Residues56
% Identity11%Templatec3bjrA_
PDB info PDB header:hydrolaseChain: A: PDB Molecule:putative carboxylesterase; PDBTitle: crystal structure of a putative carboxylesterase (lp_1002) from2 lactobacillus plantarum wcfs1 at 2.09 a resolution
Resolution2.09 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   37..40.........50.........60.........70.........80.........90.........100.........110....
Predicted Secondary structure 





























Query SS confidence 













































































Query Sequence  LAFRVQDASLPGRPDFVVDEYRCVIFTHGCFWHHHHCYLFKVPATRTEFWLEKIGKNVERDRRDISRLQELGWRVLIV
Query Conservation   
 
      

 



    
 





 



  
     
      
  
   
  

      
   

 



Alig confidence 















.


















.....................




















Template Conservation             
 
  .    
 

  



     .....................       
  

  
  
   
Template Sequence  IKQKLTATCAQLTGYL. HTNLPAIIIVPGGSYTHIP. . . . . . . . . . . . . . . . . . . . . VAQAESLAXAFAGHGYQAFYL
Template Known Secondary structure 
TTSS
.




STTT


.....................TTT
Template Predicted Secondary structure 



.













.....................


Template SS confidence 













































































   4.....10......... 20.........30........ .40.........50.........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions