Return to main results Retrieve Phyre Job Id

Job DescriptionP09184
Confidence5.97%DateThu Jan 5 11:02:09 GMT 2012
Rank88Aligned Residues26
% Identity19%Templatec2ykqC_
PDB info PDB header:rna-binding proteinChain: C: PDB Molecule:line-1 orf1p; PDBTitle: structure of the human line-1 orf1p trimer
Resolution3.10 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   28.30.........40.........50.........60.....
Predicted Secondary structure 













Query SS confidence 





































Query Sequence  LASLLTGQGLAFRVQDASLPGRPDFVVDEYRCVIFTHG
Query Conservation 
   
   
 
 
      

 



    
 





Alig confidence 
















............








Template Conservation 
 
 

  


    

............


 
    
Template Sequence  IFNILKEKNFQPRISYP. . . . . . . . . . . . AKLSFISEG
Template Known Secondary structure  TT


TT............TTT
Template Predicted Secondary structure 









............

Template SS confidence 





































   267..270.........280... ......290..
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions