Return to main results Retrieve Phyre Job Id

Job DescriptionP09184
Confidence32.97%DateThu Jan 5 11:02:09 GMT 2012
Rank14Aligned Residues36
% Identity28%Templatec2o2gA_
PDB info PDB header:hydrolaseChain: A: PDB Molecule:dienelactone hydrolase; PDBTitle: crystal structure of dienelactone hydrolase (yp_324580.1) from2 anabaena variabilis atcc 29413 at 1.92 a resolution
Resolution1.92 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   57..60.........70.........80.........90.........100.........110....
Predicted Secondary structure 




















Query SS confidence 

























































Query Sequence  YRCVIFTHGCFWHHHHCYLFKVPATRTEFWLEKIGKNVERDRRDISRLQELGWRVLIV
Query Conservation   
 





 



  
     
      
  
   
  

      
   

 



Alig confidence 















......................



















Template Conservation     

  

 
     ......................      
  

  
  

  
Template Sequence  TGIVLFAHGSGSSRYS. . . . . . . . . . . . . . . . . . . . . . PRNRYVAEVLQQAGLATLLI
Template Known Secondary structure 


TT

TT
......................T
Template Predicted Secondary structure 









......................



Template SS confidence 

























































   34.....40......... 50.........60.........
 
Download:Text version FASTA pairwise alignment 3D Model in PDB format

View in Jmol

Send structure to FirstGlance for more viewing options


Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions