Return to main results Retrieve Phyre Job Id

Job DescriptionP09184
Confidence10.28%DateThu Jan 5 11:02:09 GMT 2012
Rank58Aligned Residues41
% Identity15%Templatec2i3dA_
PDB info PDB header:structural genomics, unknown functionChain: A: PDB Molecule:hypothetical protein atu1826; PDBTitle: crystal structure of protein of unknown function atu1826, a putative2 alpha/beta hydrolase from agrobacterium tumefaciens
Resolution1.50 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   55....60.........70.........80.........90.........100.........110....
Predicted Secondary structure 





















Query SS confidence 



























































Query Sequence  DEYRCVIFTHGCFWHHHHCYLFKVPATRTEFWLEKIGKNVERDRRDISRLQELGWRVLIV
Query Conservation     
 





 



  
     
      
  
   
  

      
   

 



Alig confidence 




















...................



















Template Conservation     
 

  

 
   
    ...................         
   
      
Template Sequence  KSAPIAIILHPHPQFGGTXNN. . . . . . . . . . . . . . . . . . . QIVYQLFYLFQKRGFTTLRF
Template Known Secondary structure  TT




GGGT

TTS...................TT
Template Predicted Secondary structure 














...................


Template SS confidence 



























































   23......30.........40... ......50.........60...
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions