Return to main results Retrieve Phyre Job Id

Job DescriptionP00816
Confidence22.70%DateThu Jan 5 10:56:55 GMT 2012
Rank142Aligned Residues25
% Identity44%Templatec2xi5D_
PDB info PDB header:transferaseChain: D: PDB Molecule:rna polymerase l; PDBTitle: n-terminal endonuclease domain of la crosse virus l-protein
Resolution2.20 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   86...90.........100.........110........
Predicted Secondary structure 








Query SS confidence 
































Query Sequence  DRIPTDPTMYRFYEMLQVYGTTLKALVHEKFGD
Query Conservation     



 


 

   


   
 

 




Alig confidence 













........










Template Conservation 
 
   


  

 ........

 





 
Template Sequence  PTIVVDINFNQFFD. . . . . . . . LKQLLYEKFGD
Template Known Secondary structure 
S






........TTT
Template Predicted Secondary structure 


........


Template SS confidence 
































   150.........160... ......170....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions