Return to main results Retrieve Phyre Job Id

Job DescriptionP08394
Confidence50.65%DateThu Jan 5 11:01:26 GMT 2012
Rank489Aligned Residues45
% Identity22%Templatec3tqsB_
PDB info PDB header:transferaseChain: B: PDB Molecule:ribosomal rna small subunit methyltransferase a; PDBTitle: structure of the dimethyladenosine transferase (ksga) from coxiella2 burnetii
Resolution1.98 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   14.....20.........30.........40.........50.........60.........70......
Predicted Secondary structure 






















Query SS confidence 






























































Query Sequence  PLQGERLIEASAGTGKTFTIAALYLRLLLGLGGSAAFPRPLTVEELLVVTFTEAATAELRGRI
Query Conservation 

 
  

 







 

  
  


                 






  

 


 

Alig confidence 














...









...............



















Template Conservation        




 
 
... 

  
    ...............  
  

 
      
    
Template Sequence  PQKTDTLVEIGPGRG. . . ALTDYLLTEC. . . . . . . . . . . . . . . DNLALVEIDRDLVAFLQKKY
Template Known Secondary structure 

TT


TTT...TTTTTS...............S

Template Predicted Secondary structure 









...
...............


Template SS confidence 






























































   30.........40.... .....50.... .....60.........70....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions