Return to main results Retrieve Phyre Job Id

Job DescriptionP08394
Confidence50.19%DateThu Jan 5 11:01:26 GMT 2012
Rank494Aligned Residues44
% Identity20%Templatec2yvlB_
PDB info PDB header:transferaseChain: B: PDB Molecule:hypothetical protein; PDBTitle: crystal structure of trna (m1a58) methyltransferase trmi from aquifex2 aeolicus
Resolution2.20 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   17..20.........30.........40.........50.........60.........70........
Predicted Secondary structure 



















Query SS confidence 





























































Query Sequence  GERLIEASAGTGKTFTIAALYLRLLLGLGGSAAFPRPLTVEELLVVTFTEAATAELRGRIRS
Query Conservation 
  

 







 

  
  


                 






  

 


 

  
Alig confidence 











...









...............





















Template Conservation 
  


 
 


... 

  

   ...............
 
  

        
      
Template Sequence  EKRVLEFGTGSG. . . ALLAVLSEVA. . . . . . . . . . . . . . . GEVWTFEAVEEFYKTAQKNLKK
Template Known Secondary structure  T


TTS...S...............S
SS
Template Predicted Secondary structure 






...




...............

Template SS confidence 





























































   92.......100... ......110... ......120.........130.....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions