Return to main results Retrieve Phyre Job Id

Job DescriptionP08394
Confidence71.29%DateThu Jan 5 11:01:26 GMT 2012
Rank383Aligned Residues26
% Identity23%Templatec2vvgB_
PDB info PDB header:motor proteinChain: B: PDB Molecule:kinesin-2; PDBTitle: crystal structure of the g.intestinalis kinesin 2 gikin2a2 motor domain
Resolution1.60 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   16...20.........30.. .......40.
Predicted Secondary structure 







.........
Query SS confidence 
















. . . . . . . . .








Query Sequence  QGERLIEASAGTGKTFT. . . . . . . . . IAALYLRLL
Query Conservation   
  

 







 
.........
  
  


Alig confidence 
















.........








Template Conservation     
 


 





 

 
     


      
Template Sequence  NSTIFAYGQTGAGKTWTMGGNKEEPGAIPNSFKHL
Template Known Secondary structure 

STTSSTB
SSSB
Template Predicted Secondary structure 
















Template SS confidence 


































   90.........100.........110.........120....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions