Return to main results Retrieve Phyre Job Id

Job DescriptionP08394
Confidence89.75%DateThu Jan 5 11:01:26 GMT 2012
Rank107Aligned Residues37
% Identity27%Templatec2px0D_
PDB info PDB header:biosynthetic proteinChain: D: PDB Molecule:flagellar biosynthesis protein flhf; PDBTitle: crystal structure of flhf complexed with gmppnp/mg(2+)
Resolution3.00 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   16...20.........30.........40.........50.........60...
Predicted Secondary structure 




















Query SS confidence 















































Query Sequence  QGERLIEASAGTGKTFTIAALYLRLLLGLGGSAAFPRPLTVEELLVVT
Query Conservation   
  

 







 

  
  


                 




Alig confidence 





























...........






Template Conservation    

 





 




 



       
...........  
 

 
Template Sequence  SKYIVLFGSTGAGKTTTLAKLAAISMLEKH. . . . . . . . . . . KKIAFIT
Template Known Secondary structure  SSB


SSS
TS
...........

Template Predicted Secondary structure 








...........

Template SS confidence 















































   175....180.........190.........200.... .....210.
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions