Return to main results Retrieve Phyre Job Id

Job DescriptionP08394
Confidence58.80%DateThu Jan 5 11:01:26 GMT 2012
Rank462Aligned Residues45
% Identity31%Templatec2pwyB_
PDB info PDB header:transferaseChain: B: PDB Molecule:trna (adenine-n(1)-)-methyltransferase; PDBTitle: crystal structure of a m1a58 trna methyltransferase
Resolution1.70 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   17..20........ .30.........40.........50....... ..60.........70........
Predicted Secondary structure 






.












.
Query SS confidence 











.




























.




















Query Sequence  GERLIEASAGTG. KTFTIAALYLRLLLGLGGSAAFPRPLTVE. ELLVVTFTEAATAELRGRIRS
Query Conservation 
  

 





.

 

  
  


                . 






  

 


 

  
Alig confidence 











.









.................

.




















Template Conservation 
 



 
 


  
  

    .................  
 
   
        
      
Template Sequence  GMRVLEAGTGSGGLTLFLARAVG. . . . . . . . . . . . . . . . . EKGLVESYEARPHHLAQAERNVRA
Template Known Secondary structure  T


TTST.................TTSS
Template Predicted Secondary structure 








.................




Template SS confidence 































































   94.....100.........110...... ...120.........130.........140
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions