Return to main results Retrieve Phyre Job Id

Job DescriptionP08394
Confidence70.40%DateThu Jan 5 11:01:26 GMT 2012
Rank399Aligned Residues26
% Identity38%Templatec2h58A_
PDB info PDB header:transport proteinChain: A: PDB Molecule:kinesin-like protein kifc3 variant; PDBTitle: crystal structure of the kifc3 motor domain in complex with2 adp
Resolution1.85 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   16...20.........30.. .......40.
Predicted Secondary structure 







.........
Query SS confidence 
















. . . . . . . . .








Query Sequence  QGERLIEASAGTGKTFT. . . . . . . . . IAALYLRLL
Query Conservation   
  

 







 
.........
  
  


Alig confidence 
















.........








Template Conservation 
  
  

 





 

 
     


 
    
Template Sequence  NVCIFAYGQTGAGKTYTMEGTAENPGINQRALQLL
Template Known Secondary structure 
SSTTSSTB
SSSB
Template Predicted Secondary structure 


















Template SS confidence 


































   521........530.........540.........550.....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions