Return to main results Retrieve Phyre Job Id

Job DescriptionP08394
Confidence81.38%DateThu Jan 5 11:01:26 GMT 2012
Rank223Aligned Residues31
% Identity23%Templatec2bwjC_
PDB info PDB header:transferaseChain: C: PDB Molecule:adenylate kinase 5; PDBTitle: structure of adenylate kinase 5
Resolution2.3 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   1........10.........20.........30.........40
Predicted Secondary structure 



















Query SS confidence 







































Query Sequence  MSDVAETLDPLRLPLQGERLIEASAGTGKTFTIAALYLRL
Query Conservation 
      
     

 
  

 







 

  
  

Alig confidence 









.........




















Template Conservation 
  
 
 
 
......... 
 
  





 
  

  
Template Sequence  MEDLRKCKII. . . . . . . . . FIIGGPGSGKGTQCEKLVEKY
Template Known Secondary structure 
TS
.........
TTSS
Template Predicted Secondary structure 







.........





Template SS confidence 







































   5....10.... .....20.........30.....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions